CtIP (RBBP8) Rabbit Polyclonal Antibody

CAT#: TA339843

Rabbit Polyclonal Anti-RBBP8 Antibody

Product Images

WB Suggested Anti-RBBP8 Antibody Titration: 0.2-1 ug/ml; Positive Control: ACHN cell lysate RBBP8 is supported by BioGPS gene expression data to be expressed in ACHN

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RBBP8 antibody: synthetic peptide directed towards the middle region of human RBBP8. Synthetic peptide located within the following region: CQQKKEKRNWLPAQDTDSATFHPTHQRIFGKLVFLPLRLVWKEVILRKIL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 98 kDa
• Gene Name: RB binding protein 8, endonuclease
• Database Link:
  NP_976037
  Entrez Gene 5932 Human
  UniProt ID Q99708
• Background: RBBP8 is a ubiquitously expressed nuclear protein. It is found among several proteins that bind directly to retinoblastoma protein, which regulates cell proliferation. This protein complexes with transcriptional co-repressor CTBP. It is also associated with BRCA1 and is thought to modulate the functions of BRCA1 in transcriptional regulation, DNA repair, and/or cell cycle checkpoint control. It is suggested that this gene may itself be a tumor suppressor acting in the same pathway as BRCA1. Three transcript variants encoding two different isoforms have been found for this gene. More transcript variants exist, but their full-length natures have not been determined.
• Synonyms: COM1; CTIP; JWDS; RIM; SAE2; SCKL2
• Note: Immunogen Sequence Homology: Human: 100%