ASCL4 Rabbit Polyclonal Antibody

CAT#: TA339845

Rabbit Polyclonal Anti-ASCL4 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ASCL4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ASCL4 antibody: synthetic peptide directed towards the N terminal of human ASCL4. Synthetic peptide located within the following region: METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 19 kDa
Gene Name achaete-scute family bHLH transcription factor 4
Background ASCL4, a basic helix-loop-helix transcription factor, is essential for the determination of cell fate and the development and differentiation of numerous tissues. It could be a transcriptional regulator involved in skin development.Basic helix-loop-helix transcription factors, such as ASCL4, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]). [supplied by OMIM]
Synonyms bHLHa44; HASH4
Note Immunogen Sequence Homology: Human: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.