SFRS12 (SREK1) Rabbit Polyclonal Antibody

CAT#: TA339981

Rabbit Polyclonal Anti-SREK1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SREK1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SFRS12 antibody: synthetic peptide directed towards the N terminal of human SFRS12. Synthetic peptide located within the following region: DPSSVGVAQHLTNTVFIDRALIVVPCAEGKIPEESKALSLLAPAPTMTSL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 72 kDa
Gene Name splicing regulatory glutamic acid/lysine-rich protein 1
Background SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins.SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins (Barnard et al., 2002 [PubMed 11991645]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-78 AW963850.1 1-78 79-415 AK091758.1 1-337 416-2238 BC067770.1 609-2431 2239-3654 BC112343.1 1800-3215 3655-3660 AK125893.1 3379-3384 3661-4030 AL049309.1 705-1074
Synonyms SFRS12; SRrp86; SRrp508
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 92%; Zebrafish: 92%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.