CSNK1G2 Rabbit Polyclonal Antibody

CAT#: TA340011

Rabbit Polyclonal Anti-CSNK1G2 Antibody

Product Images

WB Suggested Anti-CSNK1G2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: A549 cell lysate

• 

  Host: Rabbit; Target Name: CSNK1G2; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CSNK1G2 antibody: synthetic peptide directed towards the middle region of human CSNK1G2. Synthetic peptide located within the following region: SKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: casein kinase 1 gamma 2
• Database Link:
  NP_001310
  Entrez Gene 1455 Human
  UniProt ID P78368
• Background: CSNK1G2 belongs to the protein kinase superfamily, CK1 Ser/Thr protein kinase family, casein kinase I subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. It participates in Wnt signaling.
• Synonyms: CK1g2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 93%; Horse: 86%; Guinea pig: 86%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Hedgehog signaling pathway