GRK2 Rabbit Polyclonal Antibody

CAT#: TA340023

Rabbit Polyclonal Anti-ADRBK1 Antibody

Product Images

WB Suggested Anti-ADRBK1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: PANC1 cell lysateADRBK1 is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADRBK1 antibody: synthetic peptide directed towards the C terminal of human ADRBK1. Synthetic peptide located within the following region: ILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 79 kDa
• Gene Name: G protein-coupled receptor kinase 2
• Database Link:
  NP_001610
  Entrez Gene 110355 MouseEntrez Gene 156 Human
  UniProt ID P25098
• Background: The product of this gene phosphorylates the beta-2-adrenergic receptor and appears to mediate agonist-specific desensitization observed at high agonist concentrations. This protein is an ubiquitous cytosolic enzyme that specifically phosphorylates the activated form of the beta-adrenergic and related G-protein-coupled receptors. Abnormal coupling of beta-adrenergic receptor to G protein is involved in the pathogenesis of the failing heart.
• Synonyms: ADRBK1; BARK1; BETA-ARK1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Chemokine signaling pathway, Endocytosis