Endothelin 2 (EDN2) Rabbit Polyclonal Antibody

CAT#: TA340037

Rabbit Polyclonal Anti-EDN2 Antibody

Product Images

WB Suggested Anti-EDN2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EDN2 antibody: synthetic peptide directed towards the n terminal of human EDN2. Synthetic peptide located within the following region: MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: endothelin 2
• Database Link:
  NP_001947
  Entrez Gene 1907 Human
  UniProt ID P20800
• Background: This gene encodes a member of the endothelin protein family of secretory vasoconstrictive peptides. The preproprotein is processed to a short mature form which functions as a ligand for the endothelin receptors that initiate intracellular signaling events. This gene product is involved in a wide range of biological processes, such as hypertension and ovulation.
• Synonyms: ET-2; ET2; PPET2
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rat: 93%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein