p40 (RABEPK) Rabbit Polyclonal Antibody

CAT#: TA340082

Rabbit Polyclonal Anti-RABEPK Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RABEPK"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RABEPK antibody: synthetic peptide directed towards the N terminal of human RABEPK. Synthetic peptide located within the following region: SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 40
Gene Name Rab9 effector protein with kelch motifs
Background RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport.
Synonyms bA65N13.1; p40; RAB9P40
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 92%; Dog: 86%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.