RPC62 (POLR3C) Rabbit Polyclonal Antibody

CAT#: TA340114

Rabbit Polyclonal Anti-POLR3C Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "POLR3C"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-POLR3C antibody: synthetic peptide directed towards the middle region of human POLR3C. Synthetic peptide located within the following region: VEAIIASMQATGAEEAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 60 kDa
Gene Name polymerase (RNA) III subunit C
Background DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3C is a specific core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. POLR3C may direct with other members of the subcomplex RNA Pol III binding to the TFIIIB-DNA complex via the interactions between TFIIIB and POLR3F. POLR3C may be involved either in the recruitment and stabilization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation. POLR3C plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses.POLR3C acts as nuclear and cytosolic DNA sensor involved in innate immune response. POLR3C can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
Synonyms RPC3; RPC62
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 90%
Reference Data
Protein Families Transcription Factors
Protein Pathways Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.