SPON2 Rabbit Polyclonal Antibody

CAT#: TA340177

Rabbit Polyclonal Anti-SPON2 Antibody

Product Images

WB Suggested Anti-SPON2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPON2 antibody: synthetic peptide directed towards the N terminal of human SPON2. Synthetic peptide located within the following region: CSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: spondin 2
• Database Link:
  NP_036577
  Entrez Gene 10417 Human
  UniProt ID Q9BUD6
• Background: SPON2 is a cell adhesion protein that promote adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. It is essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens.
• Synonyms: DIL-1; DIL1; M-SPONDIN; MINDIN
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Secreted Protein