ACAP3 Rabbit Polyclonal Antibody

CAT#: TA340202

Rabbit Polyclonal Anti-ACAP3 Antibody

Product Images

WB Suggested Anti-CENTB5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Pancreas

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CENTB5 antibody: synthetic peptide directed towards the N terminal of human CENTB5. Synthetic peptide located within the following region: LQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 85 kDa
• Gene Name: ArfGAP with coiled-coil, ankyrin repeat and PH domains 3
• Database Link:
  NP_085152
  Entrez Gene 116983 Human
  UniProt ID Q96P50
• Background: CENTB5 is a GTPase-activating protein for the ADP ribosylation factor family.
• Synonyms: CENTB5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Pathways: Endocytosis