VPS26B Rabbit Polyclonal Antibody

CAT#: TA340216

Rabbit Polyclonal Anti-VPS26B Antibody

Product Images

WB Suggested Anti-VPS26B Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VPS26B antibody: synthetic peptide directed towards the C terminal of human VPS26B. Synthetic peptide located within the following region: AGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: VPS26 retromer complex component B
• Database Link:
  NP_443107
  Entrez Gene 112936 Human
  UniProt ID Q4G0F5
• Background: VPS26B belongs to the VPS26 family. VPS26B is probable component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network.
• Synonyms: Pep8b
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 93%; Yeast: 86%; Goat: 79%