DNAAF4 Rabbit Polyclonal Antibody

CAT#: TA340263

Rabbit Polyclonal Anti-DYX1C1 Antibody

Product Images

WB Suggested Anti-DYX1C1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DYX1C1 antibody: synthetic peptide directed towards the middle region of human DYX1C1. Synthetic peptide located within the following region: TDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDPSNKIVQIDAEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: dyslexia susceptibility 1 candidate 1
• Database Link:
  NP_570722
  Entrez Gene 161582 Human
  UniProt ID Q8WXU2
• Background: This gene encodes a tetratricopeptide repeat domain-containing protein. The encoded protein interacts with estrogen receptors and the heat shock proteins, Hsp70 and Hsp90. A chromosomal translocation involving this gene is associated with a susceptibility to developmental dyslexia. Mutations in this gene are associated with deficits in reading and spelling. Alternate splicing results in multiple transcript variants.
• Synonyms: CILD25; DNAAF4; DYX1; DYXC1; EKN1; RD
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Yeast: 90%; Zebrafish: 85%