BMPER Rabbit Polyclonal Antibody

CAT#: TA340276

Rabbit Polyclonal Anti-BMPER Antibody

Product Images

WB Suggested Anti-BMPER Antibody Titration: 1 ug/ml; Positive Control: Fetal heart lysate

• 

  Immunohistochemistry with Human Lung, respiratory epethelium tissue at an antibody concentration of 5.0 ug/ml using anti-BMPER antibody

• 

  Human Lung

• 

  Human Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BMPER antibody: synthetic peptide directed towards the C terminal of human BMPER. Synthetic peptide located within the following region: NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: BMP binding endothelial regulator
• Database Link:
  NP_597725
  Entrez Gene 168667 Human
  UniProt ID Q8N8U9
• Background: BMPER contains 1 TIL (trypsin inhibitory-like) domain, 5 VWFC domains and 1 VWFD domain.BMPER is the inhibitor of bone morphogenetic protein (BMP) functions. It may regulate BMP responsiveness of osteoblasts and chondrocytes.
• Synonyms: CRIM3; CV-2; CV2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Guinea pig: 93%; Yeast: 85%; Zebrafish: 79%

Reference Data

• Protein Families: Secreted Protein