ACTRT1 Rabbit Polyclonal Antibody

CAT#: TA340281

Rabbit Polyclonal Anti-ACTRT1 Antibody

Product Images

WB Suggested Anti-ACTRT1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Pancreas

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACTRT1 antibody: synthetic peptide directed towards the middle region of human ACTRT1. Synthetic peptide located within the following region: DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: actin related protein T1
• Database Link:
  NP_612146
  Entrez Gene 139741 Human
  UniProt ID Q8TDG2
• Background: The specific function of ACTRT1 is not yet known.
• Synonyms: AIP1; ARIP1; ARPT1; HSD27
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Bovine: 92%; Pig: 86%; Rat: 86%; Mouse: 86%; Horse: 85%; Rabbit: 85%; Guinea pig: 85%