PHETA1 Rabbit Polyclonal Antibody

CAT#: TA340351

Rabbit Polyclonal Anti-FAM109A Antibody

Product Images

WB Suggested Anti-FAM109A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: U937 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FAM109A antibody: synthetic peptide directed towards the N terminal of human FAM109A. Synthetic peptide located within the following region: HRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVELVEAAEEFAFAVRFA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: family with sequence similarity 109 member A
• Database Link:
  NP_653272
  Entrez Gene 144717 Human
  UniProt ID Q8N4B1
• Background: The function of this protein remains unknown.
• Synonyms: IPIP27A; SES1
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 93%