FAM82A1 (RMDN2) Rabbit Polyclonal Antibody

CAT#: TA340361

Rabbit Polyclonal Anti-RMDN2 Antibody

Product Images

WB Suggested Anti-RMDN2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RMDN2 antibody: synthetic peptide directed towards the middle region of human RMDN2. Synthetic peptide located within the following region: WRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHLWYAV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: regulator of microtubule dynamics 2
• Database Link:
  NP_653314
  Entrez Gene 151393 Human
  UniProt ID Q96LZ7
• Background: RMDN2 belongs to the FAM82/RMD family. It is a single-pass membrane protein. The function of the RMDN2 protein remains unknown.
• Synonyms: BLOCK18; FAM82A; FAM82A1; PRO34163; PYST9371; RMD-2; RMD2; RMD4
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 92%; Guinea pig: 92%