DIRAS1 Rabbit Polyclonal Antibody

CAT#: TA340390

Rabbit Polyclonal Anti-DIRAS1 Antibody

Product Images

WB Suggested Anti-DIRAS1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DIRAS1 antibody: synthetic peptide directed towards the middle region of human DIRAS1. Synthetic peptide located within the following region: KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: DIRAS family GTPase 1
• Database Link:
  NP_660156
  Entrez Gene 148252 Human
  UniProt ID O95057
• Background: DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases. DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases. [supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3390 BC030660.1 2-3391
• Synonyms: Di-Ras1; GBTS1; RIG
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 93%; Dog: 86%; Rat: 79%; Mouse: 79%