MATH5 (ATOH7) Rabbit Polyclonal Antibody

CAT#: TA341460

Rabbit Polyclonal Anti-ATOH7 Antibody

Product Images

WB Suggested Anti-ATOH7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATOH7 antibody: synthetic peptide directed towards the C terminal of human ATOH7. Synthetic peptide located within the following region: FGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: atonal bHLH transcription factor 7
• Database Link:
  NP_660161
  Entrez Gene 220202 Human
  UniProt ID Q8N100
• Background: This intronless gene encodes a member ofThe basic helix-loop-helix family of transcription factors, with similarity to Drosophila atonal gene that controls photoreceptor development. Studies in mice suggest thatThis gene plays a central role in retinal ganglion cell and optic nerve formation. Mutations inThis gene are associated with nonsyndromic congenital retinal nonattachment. [provided by RefSeq, Dec 2011]
• Synonyms: bHLHa13; Math5; NCRNA; PHPVAR; RNANC
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Dog: 85%; Bovine: 77%

Reference Data

• Protein Families: Transcription Factors