Rex1 (ZFP42) Rabbit Polyclonal Antibody

CAT#: TA341525

Rabbit Polyclonal Anti-ZFP42 Antibody

Product Images

WB Suggested Anti-ZFP42 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the middle region of human ZFP42. Synthetic peptide located within the following region: QKVFEASSLECSLEYMKKGVKKELPQKIVGENSLEYSEYMTGKKLPPGGI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: ZFP42 zinc finger protein
• Database Link:
  NP_777560
  Entrez Gene 132625 Human
  UniProt ID Q96MM3
• Background: Involved inThe reprogramming of X-chromosome inactivation duringThe acquisition of pluripotency. Required for efficient elongation of TSIX, a non-coding RNA antisense to XIST. Binds DXPas34 enhancer withinThe TSIX promoter. Involved in ES cell self-renewal.
• Synonyms: REX-1; REX1; zfp-42; ZNF754
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Adult stem cells, Embryonic stem cells, ES Cell Differentiation/IPS, Stem cell - Pluripotency