RAD54B Rabbit Polyclonal Antibody

CAT#: TA341584

Rabbit Polyclonal Anti-RAD54B Antibody

Product Images

WB Suggested Anti-RAD54B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human brain

• 

  Rabbit Anti-RAD54B Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver; Observed Staining: Nuclear in hepatocytes, very strong signal, wide tissue distribution; Primary Antibody Concentration: 1:100; Secondary Antibody: Donkey anti-Rabbi

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAD54B antibody: synthetic peptide directed towards the N terminal of human RAD54B. Synthetic peptide located within the following region: DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 103 kDa
• Gene Name: RAD54 homolog B (S. cerevisiae)
• Database Link:
  NP_036547
  Entrez Gene 25788 Human
  UniProt ID Q9Y620
• Background: The protein encoded byThis gene belongs toThe DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA.This protein binds to double-stranded DNA, and displays ATPase activity inThe presence of DNA.This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations ofThis gene were observed in primary lymphoma and colon cancer. [provided by RefSeq, Jul 2008]
• Synonyms: RDH54
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 93%; Bovine: 86%; Dog: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Homologous recombination