DHX58 Rabbit Polyclonal Antibody

CAT#: TA341623

Rabbit Polyclonal Anti-DHX58 Antibody

Product Images

WB Suggested Anti-DHX58 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DHX58 antibody: synthetic peptide directed towards the N terminal of human DHX58. Synthetic peptide located within the following region: AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: DEXH-box helicase 58
• Database Link:
  NP_077024
  Entrez Gene 79132 Human
  UniProt ID Q96C10
• Background: DHX58 isThe negative regulator of host innate immune defense against viruses.The repressor domain of DHX58 interacts with DDX58 and negatively regulates DDX58-mediated signaling. Binds dsRNA produced during viral replication, in particuliar HCV RNA. Bin
• Synonyms: D11LGP2; D11lgp2e; LGP2; RLR-3
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 91%

Reference Data

• Protein Pathways: RIG-I-like receptor signaling pathway