DNA2 Rabbit Polyclonal Antibody

CAT#: TA341636

Rabbit Polyclonal Anti-DNA2L Antibody

Product Images

WB Suggested Anti-DNA2L Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DNA2L antibody: synthetic peptide directed towards the middle region of human DNA2L. Synthetic peptide located within the following region: KLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVSNVTE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: DNA replication helicase/nuclease 2
• Database Link:
  NP_001073918
  Entrez Gene 1763 Human
  UniProt ID P51530
• Background: DNA2 is a conserved helicase/nuclease involved inThe maintenance of mitochondrial and nuclear DNA stability (Duxin et al., 2009 [PubMed 19487465]). [supplied by OMIM, Nov 2010]. Transcript Variant:This variant (1) representsThe longer transcript and encodesThe functional protein. CCDS Note:The coding region has been updated to shortenThe N-terminus to one that is more supported byThe available transcript, conservation and publication data. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: D42046.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
• Synonyms: DNA2L; hDNA2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 92%; Rat: 86%; Horse: 86%; Rabbit: 85%; Guinea pig: 85%

Reference Data

• Protein Pathways: DNA replication