Annexin V (ANXA5) Rabbit Polyclonal Antibody

CAT#: TA341646

Rabbit Polyclonal Anti-ANXA5 Antibody

Product Images

WB Suggested Anti-ANXA5 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ANXA5 antibody: synthetic peptide directed towards the N terminal of human ANXA5. Synthetic peptide located within the following region: SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: annexin A5
• Database Link:
  NP_001145
  Entrez Gene 11747 MouseEntrez Gene 308 Human
  UniProt ID P08758
• Background: The protein encoded byThis gene belongs toThe annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. [provided by RefSeq, Jul 2008]
• Synonyms: ANX5; ENX2; HEL-S-7; PP4; RPRGL3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%