GJA5 Rabbit Polyclonal Antibody

CAT#: TA341664

Rabbit Polyclonal Anti-GJA5 Antibody

Product Images

WB Suggested Anti-GJA5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GJA5 antibody: synthetic peptide directed towards the N terminal of human GJA5. Synthetic peptide located within the following region: STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: gap junction protein alpha 5
• Database Link:
  NP_005257
  Entrez Gene 2702 Human
  UniProt ID P36382
• Background: This gene is a member ofThe connexin gene family.The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route forThe diffusion of low molecular weight materials from cell to cell. Mutations inThis gene may be associated with atrial fibrillation. Alternatively spliced transcript variants encodingThe same isoform have been described. [provided by RefSeq, Jul 2008]
• Synonyms: ATFB11; CX40
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Dog: 86%; Rabbit: 82%; Rat: 79%; Horse: 79%; Bovine: 79%

Reference Data

• Protein Families: Transmembrane