GJC1 Rabbit Polyclonal Antibody

CAT#: TA341666

Rabbit Polyclonal Anti-GJC1 Antibody

Product Images

WB Suggested Anti-GJC1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GJC1 antibody: synthetic peptide directed towards the middle region of human GJC1. Synthetic peptide located within the following region: ERLDLAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: gap junction protein gamma 1
• Database Link:
  NP_005488
  Entrez Gene 10052 Human
  UniProt ID P36383
• Background: This gene is a member ofThe connexin gene family.The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route forThe diffusion of low molecular weight materials from cell to cell. Alternatively spliced transcript variants encodingThe same isoform have been described. [provided by RefSeq, Jul 2008]
• Synonyms: CX45; GJA7
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 80%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Ion Channels: Other, Transmembrane