GJD2 Rabbit Polyclonal Antibody

CAT#: TA341671

Rabbit Polyclonal Anti-GJD2 Antibody

Product Images

WB Suggested Anti-GJD2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate GJD2 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Sample Type: mouse brain; Dilution:dilution 1:2000

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GJD2 antibody: synthetic peptide directed towards the middle region of human GJD2. Synthetic peptide located within the following region: ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: gap junction protein delta 2
• Database Link:
  NP_065711
  Entrez Gene 14617 MouseEntrez Gene 57369 Human
  UniProt ID Q9UKL4
• Background: This gene encodes a member ofThe connexin protein family. Connexins are gap junction proteins which are arranged in groups of 6 around a central pore to form a connexon, a component ofThe gap junction intercellular channel.The channels formed byThis protein allow cationic molecule exchange between human beta cells and may function inThe regulation of insulin secretion. [provided by RefSeq, Oct 2012]
• Synonyms: CX36; GJA9
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Ion Channels: Other, Transmembrane
• Protein Pathways: Gap junction