GJA3 Rabbit Polyclonal Antibody

CAT#: TA341673

Rabbit Polyclonal Anti-GJA3 Antibody

Product Images

WB Suggested Anti-GJA3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 721_B cell lysate GJA3 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GJA3 antibody: synthetic peptide directed towards the N terminal of human GJA3. Synthetic peptide located within the following region: ISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: gap junction protein alpha 3
• Database Link:
  NP_068773
  Entrez Gene 2700 Human
  UniProt ID Q9Y6H8
• Background: The protein encoded byThis gene is a connexin and is a component of lens fiber gap junctions. Defects inThis gene are a cause of zonular pulverulent cataract type 3 (CZP3). [provided by RefSeq, Jan 2010]
• Synonyms: CTRCT14; CX46; CZP3
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 91%; Horse: 91%; Yeast: 91%; Rat: 90%; Zebrafish: 90%; Mouse: 83%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane