GJA3 Rabbit Polyclonal Antibody
Other products for "GJA3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GJA3 antibody: synthetic peptide directed towards the N terminal of human GJA3. Synthetic peptide located within the following region: ISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 47 kDa |
Gene Name | gap junction protein alpha 3 |
Database Link | |
Background | The protein encoded byThis gene is a connexin and is a component of lens fiber gap junctions. Defects inThis gene are a cause of zonular pulverulent cataract type 3 (CZP3). [provided by RefSeq, Jan 2010] |
Synonyms | CTRCT14; CX46; CZP3 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 91%; Horse: 91%; Yeast: 91%; Rat: 90%; Zebrafish: 90%; Mouse: 83% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.