MCM3 Rabbit Polyclonal Antibody

CAT#: TA341683

Rabbit Polyclonal Anti-MCM3 Antibody

Product Images

WB Suggested Anti-MCM3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate MCM3 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Human Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MCM3 antibody: synthetic peptide directed towards the C terminal of human MCM3. Synthetic peptide located within the following region: SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 89 kDa
• Gene Name: minichromosome maintenance complex component 3
• Database Link:
  NP_002379
  Entrez Gene 4172 Human
  UniProt ID P25205
• Background: The protein encoded byThis gene is one ofThe highly conserved mini-chromosome maintenance proteins (MCM) that are involved inThe initiation of eukaryotic genome replication.The hexameric protein complex formed by MCM proteins is a key component ofThe pre-replication complex (pre_RC) and may be involved inThe formation of replication forks and inThe recruitment of other DNA replication related proteins.This protein is a subunit ofThe protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46.This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase.The acetylation ofThis protein inhibitsThe initiation of DNA replication and cell cycle progression. Two transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jul 2012]
• Synonyms: HCC5; P1-MCM3; P1.h; RLFB
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Dog: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 92%; Bovine: 92%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transcription Factors
• Protein Pathways: Cell cycle, DNA replication