Z DNA binding protein (ZBP1) Rabbit Polyclonal Antibody

CAT#: TA341712

Rabbit Polyclonal Anti-ZBP1 Antibody

Product Images

WB Suggested Anti-ZBP1 Antibody; Titration: 5.0 ug/ml; Positive Control: HepG2 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZBP1 antibody: synthetic peptide directed towards the middle region of human ZBP1. Synthetic peptide located within the following region: LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: Z-DNA binding protein 1
• Database Link:
  NP_110403
  Entrez Gene 81030 Human
  UniProt ID Q9H171
• Background: This gene encodes a Z-DNA binding protein.The encoded protein plays a role inThe innate immune response by binding to foreign DNA and inducing type-I interferon production. Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, Dec 2011]
• Synonyms: C20orf183; DAI; DLM-1; DLM1
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Pathways: Cytosolic DNA-sensing pathway