TPTE Rabbit Polyclonal Antibody

CAT#: TA341721

Rabbit Polyclonal Anti-TPTE Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TPTE"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TPTE antibody: synthetic peptide directed towards the C terminal of human TPTE. Synthetic peptide located within the following region: KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 45 kDa
Gene Name transmembrane phosphatase with tensin homology
Background This gene encodes a PTEN-related tyrosine phosphatase which may play a role inThe signal transduction pathways ofThe endocrine or spermatogenic function ofThe testis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
Synonyms CT44; PTEN2
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.