KCNRG Rabbit Polyclonal Antibody

CAT#: TA341722

Rabbit Polyclonal Anti-KCNRG Antibody

Product Images

WB Suggested Anti-KCNRG Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNRG antibody: synthetic peptide directed towards the N terminal of human KCNRG. Synthetic peptide located within the following region: MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: potassium channel regulator
• Database Link:
  NP_775876
  Entrez Gene 283518 Human
  UniProt ID Q8N5I3
• Background: This gene encodes a protein which regulatesThe activity of voltage-gated potassium channels.This gene is on chromosome 13 and overlapsThe gene for tripartite motif containing 13 onThe same strand. Multiple transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Feb 2012]
• Synonyms: DLTET
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%