AKAP7 Rabbit Polyclonal Antibody
Other products for "AKAP7"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-AKAP7 antibody: synthetic peptide directed towards the middle region of human AKAP7. Synthetic peptide located within the following region: DERLAKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 37 kDa |
Gene Name | A-kinase anchoring protein 7 |
Database Link | |
Background | This gene encodes a member ofThe A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and targetThe enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Apr 2011] |
Synonyms | AKAP15; AKAP18 |
Note | Immunogen Sequence Homology: Pig: 91%; Human: 91%; Rabbit: 91%; Bovine: 82%; Guinea pig: 82% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.