AKAP7 Rabbit Polyclonal Antibody

CAT#: TA341732

Rabbit Polyclonal Anti-AKAP7 Antibody

Product Images

WB Suggested Anti-AKAP7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AKAP7 antibody: synthetic peptide directed towards the middle region of human AKAP7. Synthetic peptide located within the following region: DERLAKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: A-kinase anchoring protein 7
• Database Link:
  NP_057461
  Entrez Gene 9465 Human
  UniProt ID O43687
• Background: This gene encodes a member ofThe A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and targetThe enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Apr 2011]
• Synonyms: AKAP15; AKAP18
• Note: Immunogen Sequence Homology: Pig: 91%; Human: 91%; Rabbit: 91%; Bovine: 82%; Guinea pig: 82%

Reference Data

• Protein Families: Druggable Genome