Arntl Rabbit Polyclonal Antibody

CAT#: TA341744

Rabbit Polyclonal Anti-ARNTL Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Arntl"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of mouse ARNTL. Synthetic peptide located within the following region: SGVDCNRKRKGSATDYQLDDFAFEESMDTDKDDPHGRLEYAEHQGRIKNA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name aryl hydrocarbon receptor nuclear translocator-like
Background The protein encoded byThis gene is a basic helix-loop-helix protein that forms a heterodimer with Clock.This heterodimer binds E-box enhancer elements upstream of Period (Per1, Per2, Per3) and Cryptochrome (Cry1, Cry2) genes and activates transcription ofThese genes. Per and Cry proteins heterodimerize and repressTheir own transcription by interacting in a feedback loop with Clock/Arntl complexes. Defects inThis gene have been linked to infertility, problems with gluconeogenesis and lipogenesis, and altered sleep patterns. Two transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jan 2014]
Synonyms bHLHe5; BMAL1; BMAL1c; JAP3; MGC47515; MOP3; PASD3; TIC
Note Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Human: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.