Arntl Rabbit Polyclonal Antibody

CAT#: TA341744

Rabbit Polyclonal Anti-ARNTL Antibody

Product Images

WB Suggested Anti-ARNTL Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: NIH/3T3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of mouse ARNTL. Synthetic peptide located within the following region: SGVDCNRKRKGSATDYQLDDFAFEESMDTDKDDPHGRLEYAEHQGRIKNA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: aryl hydrocarbon receptor nuclear translocator-like
• Database Link:
  NP_001229977
  Entrez Gene 11865 Mouse
  UniProt ID Q9WTL8
• Background: The protein encoded byThis gene is a basic helix-loop-helix protein that forms a heterodimer with Clock.This heterodimer binds E-box enhancer elements upstream of Period (Per1, Per2, Per3) and Cryptochrome (Cry1, Cry2) genes and activates transcription ofThese genes. Per and Cry proteins heterodimerize and repressTheir own transcription by interacting in a feedback loop with Clock/Arntl complexes. Defects inThis gene have been linked to infertility, problems with gluconeogenesis and lipogenesis, and altered sleep patterns. Two transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jan 2014]
• Synonyms: bHLHe5; BMAL1; BMAL1c; JAP3; MGC47515; MOP3; PASD3; TIC
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Human: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%