Gata5 Rabbit Polyclonal Antibody
Other products for "Gata5"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GATA5 antibody: synthetic peptide directed towards the C terminal of mouse GATA5. Synthetic peptide located within the following region: SPTLLNSESSATTLKAESSLASPVCAGPTITSQASSPADESLASSHLEFK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 44 kDa |
Gene Name | GATA binding protein 5 |
Database Link | |
Background | Binds toThe functionally important CEF-1 nuclear protein binding site inThe cardiac-specific slow/cardiac troponin C transcriptional enhancer. May play an important role inThe transcriptional program(s) that underlies smooth muscle cell diversity. |
Synonyms | bB379O24.1; OTTHUMP00000031490 |
Note | Immunogen Sequence Homology: Rat: 100%; Mouse: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.