Gata5 Rabbit Polyclonal Antibody

CAT#: TA341766

Rabbit Polyclonal Anti-GATA5 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Gata5"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GATA5 antibody: synthetic peptide directed towards the C terminal of mouse GATA5. Synthetic peptide located within the following region: SPTLLNSESSATTLKAESSLASPVCAGPTITSQASSPADESLASSHLEFK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 44 kDa
Gene Name GATA binding protein 5
Background Binds toThe functionally important CEF-1 nuclear protein binding site inThe cardiac-specific slow/cardiac troponin C transcriptional enhancer. May play an important role inThe transcriptional program(s) that underlies smooth muscle cell diversity.
Synonyms bB379O24.1; OTTHUMP00000031490
Note Immunogen Sequence Homology: Rat: 100%; Mouse: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.