HOXB9 Rabbit Polyclonal Antibody

CAT#: TA341781

Rabbit Polyclonal Anti-Hoxb9 Antibody

Product Images

WB Suggested Anti-Hoxb9 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Hoxb9 antibody: synthetic peptide directed towards the n terminal of mouse Hoxb9. Synthetic peptide located within the following region: MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYANPRQPGHAEHLDFPSC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28
• Gene Name: homeobox B9
• Database Link:
  NP_076922
  Entrez Gene 15417 Mouse
  UniProt ID P17482
• Background: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities onThe anterior-posterior axis.
• Synonyms: HOX-2.5; HOX2; HOX2E
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors