Mef2b Rabbit Polyclonal Antibody

CAT#: TA341792

Rabbit Polyclonal Anti-MEF2B Antibody

Product Images

WB Suggested Anti-MEF2B Antibody Titration: 0.625 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Lymphnode

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MEF2B antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PVARSLCKEGPPSRGASPPTPPVSIKSERLSPVTGTSGDFPRSFPYPLLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: myocyte enhancer factor 2B
• Database Link:
  NP_032604
  Entrez Gene 100271849 Human
• Background: MEF2b is involved in regulation of fast Myosin heavy chain transcription
• Synonyms: FLJ32648; RSRFR2; XMEF2
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%