Menin (MEN1) Rabbit Polyclonal Antibody

CAT#: TA341793

Rabbit Polyclonal Anti-Men1 Antibody

Product Images

WB Suggested Anti-Men1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Men1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YNYCREDEEIYKEFFEVANDVIPNLLKEAASLLETGEERTGEQAQGTQGQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: menin 1
• Database Link:
  NP_570711
  Entrez Gene 17283 Mouse
  UniProt ID O00255
• Background: Men1 may be involved in DNA repair. Men1 is a component of MLL-containing complexes (named MLL, ASCOM, MLL2/MLL3 or MLL3/MLL4 complex): at least composed ASH2L, RBBP5, DPY30, WDR5, one or several histone methyltransferases (MLL, MLL2, MLL3 and/or MLL4), andThe facultative components MEN1, HCFC1, HCFC2, NCOA6, KDM6A, PAXIP1/PTIP and C16orf53/PA1.
• Synonyms: MEAI; SCG2
• Note: Immunogen Sequence Homology: Mouse: 100%; Pig: 92%; Rat: 92%; Horse: 85%; Human: 85%; Bovine: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors