SIN3B Rabbit Polyclonal Antibody

CAT#: TA341813

Rabbit Polyclonal Anti-SIN3B Antibody

Product Images

WB Suggested Anti-SIN3B Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:1562500; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SIN3B antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NIQSPLSSQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 105 kDa
• Gene Name: SIN3 transcription regulator family member B
• Database Link:
  NP_056075
  Entrez Gene 20467 Mouse
  UniProt ID O75182
• Background: Sin3B is one ofThe Sin3 co-repressors act as a protein scaffold to recruit transcription factors via its four highly homologous paired amphipathic helix (PAH) domains.
• Synonyms: KIAA0700
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 86%; Pig: 86%; Human: 86%; Bovine: 86%; Horse: 79%