LMAN2 Rabbit Polyclonal Antibody

CAT#: TA341862

Rabbit Polyclonal Anti-LMAN2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "LMAN2"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-LMAN2 antibody: synthetic peptide directed towards the N terminal of human LMAN2. Synthetic peptide located within the following region: SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name lectin, mannose binding 2
Background This gene encodes a type I transmembrane lectin that shuttles betweenThe endoplasmic reticulum,The Golgi apparatus andThe plasma membrane.The encoded protein binds high mannose type glycoproteins and may facilitateTheir sorting, trafficking and quality control. [provided by RefSeq, Oct 2008]
Synonyms C5orf8; GP36B; VIP36
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.