TSPAN15 Rabbit Polyclonal Antibody

CAT#: TA341909

Rabbit Polyclonal Anti-TSPAN15 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TSPAN15"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TSPAN15 antibody: synthetic peptide directed towards the C terminal of human TSPAN15. Synthetic peptide located within the following region: LGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGC
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 33 kDa
Gene Name tetraspanin 15
Background The protein encoded byThis gene is a member ofThe transmembrane 4 superfamily, also known asThe tetraspanin family. Most ofThese members are cell-surface proteins that are characterized byThe presence of four hydrophobic domains.The proteins mediate signal transduction events that play a role inThe regulation of cell development, activation, growth and motility.The use of alternate polyadenylation sites has been found forThis gene. [provided by RefSeq, Jul 2008]
Synonyms 2700063A19Rik; NET-7; NET7; TM4SF15
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.