NRG1 Rabbit Polyclonal Antibody

CAT#: TA341924

Rabbit Polyclonal Anti-NRG1 Antibody

Product Images

NRG1 (neuregulin 1) Antibody (against the N terminal of NRG1) (50ug) validated by WB using Fetal Brain Lysate at 0.2-1 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: Synthetic peptide directed towards the N terminal of human NRG1. Synthetic peptide located within the following region: YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: neuregulin 1
• Database Link:
  NP_039251
  Entrez Gene 3084 Human
  UniProt ID Q02297
• Background: The protein encoded byThis gene is a membrane glycoprotein that that mediates cell-cell signaling and plays a critical role inThe growth and development of multiple organ systems. An extraordinary variety of different isoforms are produced fromThis gene through alternative promoter usage and splicing.These isoforms are expressed in a tissue-specific manner and differ significantly inTheir structure, and are classified as types I, II, III, IV, V and VI. Dysregulation ofThis gene has been linked to diseases such as cancer, schizophrenia, and bipolar disorder (BPD). [provided by RefSeq, Jun 2014]
• Synonyms: ARIA; GGF; GGF2; HGL; HRG; HRG1; HRGA; MST131; MSTP131; NDF; NRG1-IT2; SMDF
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transcription Factors, Transmembrane
• Protein Pathways: ErbB signaling pathway