NRG1 Rabbit Polyclonal Antibody
Other products for "NRG1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | Synthetic peptide directed towards the middle region of human NRG1. Synthetic peptide located within the following region: SEVQVTVQGDKAVVSFEPSAAPTPKNRIFAFSFLPSTAPSFPSPTRNPEV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 32 kDa |
Gene Name | neuregulin 1 |
Database Link | |
Background | The protein encoded byThis gene is a membrane glycoprotein that that mediates cell-cell signaling and plays a critical role inThe growth and development of multiple organ systems. An extraordinary variety of different isoforms are produced fromThis gene through alternative promoter usage and splicing.These isoforms are expressed in a tissue-specific manner and differ significantly inTheir structure, and are classified as types I, II, III, IV, V and VI. Dysregulation ofThis gene has been linked to diseases such as cancer, schizophrenia, and bipolar disorder (BPD). [provided by RefSeq, Jun 2014] |
Synonyms | ARIA; GGF; GGF2; HGL; HRG; HRG1; HRGA; MST131; MSTP131; NDF; NRG1-IT2; SMDF |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 91%; Bovine: 91%; Guinea pig: 91% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein, Transcription Factors, Transmembrane |
Protein Pathways | ErbB signaling pathway |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.