Siglec 7 (SIGLEC7) Rabbit Polyclonal Antibody

CAT#: TA341935

Rabbit Polyclonal Anti-SIGLEC7 Antibody

Product Images

WB Suggested Anti-SIGLEC7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 721_B cell lysate.SIGLEC7 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SIGLEC7 antibody: synthetic peptide directed towards the middle region of human SIGLEC7. Synthetic peptide located within the following region: WRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: sialic acid binding Ig like lectin 7
• Database Link:
  NP_055200
  Entrez Gene 27036 Human
  UniProt ID Q9Y286
• Background: SIGLEC7 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. InThe immune response, it may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) viaTheir SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. SIGLEC7 mediates inhibition of natural killer cells cytotoxicity. It may also play a role in hemopoiesis. SIGLEC7 inhibits differentiation of CD34+ cell precursors towards myelomonocytic cell lineage and proliferation of leukemic myeloid cells (in vitro).
• Synonyms: AIRM1; CD328; CDw328; D-siglec; p75; QA79; SIGLEC-7; SIGLEC19P; SIGLECP2
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 92%; Pig: 86%; Guinea pig: 86%; Bovine: 85%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transmembrane