ABI3BP Rabbit Polyclonal Antibody

CAT#: TA341975

Rabbit Polyclonal Anti-ABI3BP Antibody

Product Images

Host: Rabbit; Target Name: ABI3BP; Sample Tissue: Thymus Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ABI3BP antibody is: synthetic peptide directed towards the C-terminal region of Human ABI3BP. Synthetic peptide located within the following region: PVSNTVAFSTESADPRVSEPVSAGRDAIWTERPFNSDSYSECKGKQYVKR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: ABI family member 3 binding protein
• Database Link:
  NP_056244
  Entrez Gene 25890 Human
  UniProt ID Q7Z7G0
• Background: ABI3BP contains 2 fibronectin type-III domains.The loss of ABI3BP expression could play a functional role in thyroid tumorigenesis. It also presumably represents a trigger gene for evoking cellular senescence, which has also been suggested to be involved inThe prevention of tumorigenesis.
• Synonyms: NESHBP; TARSH
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane