ATL3 Rabbit Polyclonal Antibody
Other products for "ATL3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DKFZP564J0863 antibody: synthetic peptide directed towards the middle region of human DKFZP564J0863. Synthetic peptide located within the following region: IYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 60 kDa |
Gene Name | atlastin GTPase 3 |
Database Link | |
Background | This gene encodes a member of a family of dynamin-like, integral membrane GTPases.The encoded protein is required forThe proper formation ofThe network of interconnected tubules ofThe endoplasmic reticulum. Mutations inThis gene may be associated with hereditary sensory neuropathy type IF. Alternatively spliced transcript variants that encode distinct isoforms have been described. [provided by RefSeq, Feb 2014] |
Synonyms | HSN1F |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.