SHISA5 Rabbit Polyclonal Antibody
Other products for "SHISA5"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SCOTIN antibody: synthetic peptide directed towards the middle region of human SCOTIN. Synthetic peptide located within the following region: CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 25 kDa |
Gene Name | shisa family member 5 |
Database Link | |
Background | This gene encodes a member ofThe shisa family.The encoded protein is localized toThe endoplasmic reticulum, and together with p53 induces apoptosis in a caspase-dependent manner. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013] |
Synonyms | SCOTIN |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | p53 signaling pathway |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.