Seli Rabbit Polyclonal Antibody

CAT#: TA342061

Rabbit Polyclonal Anti-Seli Antibody

Product Images

Host: Rabbit; Target Name: Seli; Sample Tissue: Rat Small Intestine lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Seli antibody is: synthetic peptide directed towards the N-terminal region of Rat Seli. Synthetic peptide located within the following region: FMLLVFNFLLLTYFDPDFYASAPGHKHVPDWVWIVVGILNFVAYTLDGVD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: selenoprotein I
• Database Link:
  NP_001128226
  Entrez Gene 362713 Rat
• Background: This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site.The selenocysteine is encoded byThe UGA codon that normally signals translation termination.The 3' UTR of selenoprotein genes have a common stem-loop structure,The sec insertion sequence (SECIS), that is necessary forThe recognition of UGA as a Sec codon rather than as a stop signal.
• Synonyms: EPT1; hEPT1; KIAA1724; OTTHUMP00000200812
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%