Seli Rabbit Polyclonal Antibody
Other products for "Selenoi"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Rat |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Seli antibody is: synthetic peptide directed towards the N-terminal region of Rat Seli. Synthetic peptide located within the following region: FMLLVFNFLLLTYFDPDFYASAPGHKHVPDWVWIVVGILNFVAYTLDGVD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 43 kDa |
Gene Name | selenoprotein I |
Database Link | |
Background | This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site.The selenocysteine is encoded byThe UGA codon that normally signals translation termination.The 3' UTR of selenoprotein genes have a common stem-loop structure,The sec insertion sequence (SECIS), that is necessary forThe recognition of UGA as a Sec codon rather than as a stop signal. |
Synonyms | EPT1; hEPT1; KIAA1724; OTTHUMP00000200812 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.