RFT1 Rabbit Polyclonal Antibody

CAT#: TA342065

Rabbit Polyclonal Anti-RFT1 Antibody

Product Images

WB Suggested Anti-RFT1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RFT1 antibody: synthetic peptide directed towards the N terminal of human RFT1. Synthetic peptide located within the following region: GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: RFT1 homolog
• Database Link:
  NP_443091
  Entrez Gene 91869 Human
  UniProt ID Q96AA3
• Background: N-glycosylation of proteins follows a highly conserved pathway that begins withThe synthesis of a¡¡Man(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate onThe cytoplasmic side ofThe endoplasmic reticulum (ER) membrane followed byThe translocation of Man(5)GlcNAc (2)-PP-Dol toThe luminal side ofThe ER membrane. RFT1 isThe flippase enzyme that catalyzesThis translocation.N-glycosylation of proteins follows a highly conserved pathway that begins withThe synthesis of a Man(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate onThe cytoplasmic side ofThe endoplasmic reticulum (ER) membrane followed byThe translocation of Man(5)GlcNAc (2)-PP-Dol toThe luminal side ofThe ER membrane. RFT1 isThe flippase enzyme that catalyzesThis translocation (Helenius et al., 2002 [PubMed 11807558]). [supplied by OMIM]
• Synonyms: CDG1N
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%; Mouse: 85%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: N-Glycan biosynthesis