EMID1 Rabbit Polyclonal Antibody

CAT#: TA342105

Rabbit Polyclonal Anti-EMID1 Antibody

Product Images

WB Suggested Anti-EMID1 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysateEMID1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EMID1 antibody: synthetic peptide directed towards the C terminal of human EMID1. Synthetic peptide located within the following region: TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: EMI domain containing 1
• Database Link:
  NP_597712
  Entrez Gene 129080 Human
  UniProt ID Q96A84
• Background: EMID1 contains 1 collagen-like domain and 1 EMI domain.The exact function of EMID1 remains unknown.
• Synonyms: EMI5; EMU1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Secreted Protein, Transmembrane