HIPK1 Rabbit Polyclonal Antibody

CAT#: TA342143

Rabbit polyclonal Anti-HIPK1 Antibody

Product Images

WB Suggested Anti-HIPK1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HIPK1 antibody: synthetic peptide directed towards the middle region of human HIPK1. Synthetic peptide located within the following region: PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 131 kDa
• Gene Name: homeodomain interacting protein kinase 1
• Database Link:
  NP_938010
  Entrez Gene 204851 Human
  UniProt ID Q86Z02
• Background: The protein encoded byThis gene belongs toThe Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms. [provided by RefSeq, Jul 2008]
• Synonyms: Myak; Nbak2
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase, Transcription Factors